General Information

  • ID:  hor000309
  • Uniprot ID:  A7LBN3??59-65)
  • Protein name:  Allatostatin A
  • Gene name:  NA
  • Organism:  Calanus finmarchicus (Calanus tonsus)
  • Family:  Allatostatin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Calanus (genus), Calanidae (family), Calanoida (order), Gymnoplea (superorder), Neocopepoda (infraclass), Copepoda (subclass), Hexanauplia (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  EPYGFGI
  • Length:  7(59-65)
  • Propeptide:  MLLWILLCQLTLTYGARPYNGQQGTMLANLAFNDNNSNGLDYEIGEDGPDTDIDVSKREPYGFGIGKRAPYGFGIGKRALYGFGIGKRAPYGFGIGKRAPYGFGIGKREPYNFGIGKRSQMWGKRQPYNFGVGKRGMLAL
  • Signal peptide:  MLLWILLCQLTLTYG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A7LBN3-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000309_AF2.pdbhor000309_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 88906 Formula: C38H51N7O11
Absent amino acids: ACDHKLMNQRSTVW Common amino acids: G
pI: 3.85 Basic residues: 0
Polar residues: 3 Hydrophobic residues: 2
Hydrophobicity: 1.43 Boman Index: 283
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 55.71
Instability Index: 1182.86 Extinction Coefficient cystines: 1490
Absorbance 280nm: 248.33

Literature

  • PubMed ID:  17950732
  • Title:  Identification of A-type Allatostatins Possessing -YXFGI/Vamide Carboxy-Termini From the Nervous System of the Copepod Crustacean Calanus Finmarchicus